Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028825-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FABP7
Alternative Gene Name: B-FABP, BLBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019874: 89%, ENSRNOG00000000814: 90%
Entrez Gene ID: 2173
Uniprot ID: O15540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK |
| Gene Sequence | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK |
| Gene ID - Mouse | ENSMUSG00000019874 |
| Gene ID - Rat | ENSRNOG00000000814 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) | |
| Datasheet | Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) | |
| Datasheet | Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) |
| Citations for Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) – 2 Found |
| Tan, Cheng; Takayama, Tatsuya; Takaoka, Naohisa; Fujita, Hiromi; Miyazaki, Miki; Sugiyama, Takayuki; Ozono, Seiichiro. Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival. Clinical Medicine Insights. Oncology. 8( 24653654):21-7. PubMed |
| Gromov, Pavel; Espinoza, Jaime A; Talman, Maj-Lis; Honma, Naoko; Kroman, Niels; Timmermans Wielenga, Vera; Moreira, José M A; Gromova, Irina. FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast. Plos One. 9(11):e112024. PubMed |