Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028825-25

• 
• 

Protein Description: fatty acid binding protein 7, brain
Gene Name: FABP7
Alternative Gene Name: B-FABP, BLBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019874: 89%, ENSRNOG00000000814: 90%
Entrez Gene ID: 2173
Uniprot ID: O15540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
• Gene Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
• Gene ID - Mouse: ENSMUSG00000019874
• Gene ID - Rat: ENSRNOG00000000814
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FABP7 pAb (ATL-HPA028825 w/enhanced validation) – 2 Found

Tan, Cheng; Takayama, Tatsuya; Takaoka, Naohisa; Fujita, Hiromi; Miyazaki, Miki; Sugiyama, Takayuki; Ozono, Seiichiro. Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival. Clinical Medicine Insights. Oncology. 8( 24653654):21-7. 

Gromov, Pavel; Espinoza, Jaime A; Talman, Maj-Lis; Honma, Naoko; Kroman, Niels; Timmermans Wielenga, Vera; Moreira, José M A; Gromova, Irina. FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast. Plos One. 9(11):e112024.