Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA034607-25
  • Immunohistochemistry analysis in human small intestine and liver tissues using HPA034607 antibody. Corresponding FABP2 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424906).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fatty acid binding protein 2, intestinal
Gene Name: FABP2
Alternative Gene Name: I-FABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023057: 72%, ENSRNOG00000024947: 66%
Entrez Gene ID: 2169
Uniprot ID: P12104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Gene Sequence LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Gene ID - Mouse ENSMUSG00000023057
Gene ID - Rat ENSRNOG00000024947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation)
Datasheet Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation)
Datasheet Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation)