Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034607-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FABP2
Alternative Gene Name: I-FABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023057: 72%, ENSRNOG00000024947: 66%
Entrez Gene ID: 2169
Uniprot ID: P12104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA |
| Gene Sequence | LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA |
| Gene ID - Mouse | ENSMUSG00000023057 |
| Gene ID - Rat | ENSRNOG00000024947 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) | |
| Datasheet | Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) | |
| Datasheet | Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation) |