Anti FABP2 pAb (ATL-HPA034607 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA034607-25

• 
• 

Protein Description: fatty acid binding protein 2, intestinal
Gene Name: FABP2
Alternative Gene Name: I-FABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023057: 72%, ENSRNOG00000024947: 66%
Entrez Gene ID: 2169
Uniprot ID: P12104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
• Gene Sequence: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
• Gene ID - Mouse: ENSMUSG00000023057
• Gene ID - Rat: ENSRNOG00000024947
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.