Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028275-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fatty acid binding protein 1, liver
Gene Name: FABP1
Alternative Gene Name: L-FABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054422: 84%, ENSRNOG00000006675: 83%
Entrez Gene ID: 2168
Uniprot ID: P07148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Gene Sequence MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Gene ID - Mouse ENSMUSG00000054422
Gene ID - Rat ENSRNOG00000006675
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation)
Datasheet Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation)
Datasheet Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation)
Citations for Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) – 3 Found
Wu, Yun-Li; Peng, Xian-E; Zhu, Yi-Bing; Yan, Xiao-Li; Chen, Wan-Nan; Lin, Xu. Hepatitis B Virus X Protein Induces Hepatic Steatosis by Enhancing the Expression of Liver Fatty Acid Binding Protein. Journal Of Virology. 2016;90(4):1729-40.  PubMed
Mikus, Maria; Drobin, Kimi; Gry, Marcus; Bachmann, Julie; Lindberg, Johan; Yimer, Getnet; Aklillu, Eleni; Makonnen, Eyasu; Aderaye, Getachew; Roach, James; Fier, Ian; Kampf, Caroline; Göpfert, Jens; Perazzo, Hugo; Poynard, Thierry; Stephens, Camilla; Andrade, Raúl J; Lucena, M Isabel; Arber, Nadir; Uhlén, Mathias; Watkins, Paul B; Schwenk, Jochen M; Nilsson, Peter; Schuppe-Koistinen, Ina. Elevated levels of circulating CDH5 and FABP1 in association with human drug-induced liver injury. Liver International : Official Journal Of The International Association For The Study Of The Liver. 2017;37(1):132-140.  PubMed
Huang, Zhiguang; Zhang, Menglu; Plec, Abigail A; Estill, Sandi Jo; Cai, Ling; Repa, Joyce J; McKnight, Steven L; Tu, Benjamin P. ACSS2 promotes systemic fat storage and utilization through selective regulation of genes involved in lipid metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9499-E9506.  PubMed