Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028275-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FABP1
Alternative Gene Name: L-FABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054422: 84%, ENSRNOG00000006675: 83%
Entrez Gene ID: 2168
Uniprot ID: P07148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Gene Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Gene ID - Mouse | ENSMUSG00000054422 |
| Gene ID - Rat | ENSRNOG00000006675 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) | |
| Datasheet | Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) | |
| Datasheet | Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) |
| Citations for Anti FABP1 pAb (ATL-HPA028275 w/enhanced validation) – 3 Found |
| Wu, Yun-Li; Peng, Xian-E; Zhu, Yi-Bing; Yan, Xiao-Li; Chen, Wan-Nan; Lin, Xu. Hepatitis B Virus X Protein Induces Hepatic Steatosis by Enhancing the Expression of Liver Fatty Acid Binding Protein. Journal Of Virology. 2016;90(4):1729-40. PubMed |
| Mikus, Maria; Drobin, Kimi; Gry, Marcus; Bachmann, Julie; Lindberg, Johan; Yimer, Getnet; Aklillu, Eleni; Makonnen, Eyasu; Aderaye, Getachew; Roach, James; Fier, Ian; Kampf, Caroline; Göpfert, Jens; Perazzo, Hugo; Poynard, Thierry; Stephens, Camilla; Andrade, Raúl J; Lucena, M Isabel; Arber, Nadir; Uhlén, Mathias; Watkins, Paul B; Schwenk, Jochen M; Nilsson, Peter; Schuppe-Koistinen, Ina. Elevated levels of circulating CDH5 and FABP1 in association with human drug-induced liver injury. Liver International : Official Journal Of The International Association For The Study Of The Liver. 2017;37(1):132-140. PubMed |
| Huang, Zhiguang; Zhang, Menglu; Plec, Abigail A; Estill, Sandi Jo; Cai, Ling; Repa, Joyce J; McKnight, Steven L; Tu, Benjamin P. ACSS2 promotes systemic fat storage and utilization through selective regulation of genes involved in lipid metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9499-E9506. PubMed |