Anti FAAP24 pAb (ATL-HPA041168)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041168-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAAP24
Alternative Gene Name: C19orf40, FLJ46828, MGC32020
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030493: 83%, ENSRNOG00000022393: 83%
Entrez Gene ID: 91442
Uniprot ID: Q9BTP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ |
Gene Sequence | VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ |
Gene ID - Mouse | ENSMUSG00000030493 |
Gene ID - Rat | ENSRNOG00000022393 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAAP24 pAb (ATL-HPA041168) | |
Datasheet | Anti FAAP24 pAb (ATL-HPA041168) Datasheet (External Link) |
Vendor Page | Anti FAAP24 pAb (ATL-HPA041168) at Atlas Antibodies |
Documents & Links for Anti FAAP24 pAb (ATL-HPA041168) | |
Datasheet | Anti FAAP24 pAb (ATL-HPA041168) Datasheet (External Link) |
Vendor Page | Anti FAAP24 pAb (ATL-HPA041168) |