Anti FAAP24 pAb (ATL-HPA041168)

Atlas Antibodies

SKU:
ATL-HPA041168-25
  • Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia core complex associated protein 24
Gene Name: FAAP24
Alternative Gene Name: C19orf40, FLJ46828, MGC32020
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030493: 83%, ENSRNOG00000022393: 83%
Entrez Gene ID: 91442
Uniprot ID: Q9BTP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ
Gene Sequence VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ
Gene ID - Mouse ENSMUSG00000030493
Gene ID - Rat ENSRNOG00000022393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAAP24 pAb (ATL-HPA041168)
Datasheet Anti FAAP24 pAb (ATL-HPA041168) Datasheet (External Link)
Vendor Page Anti FAAP24 pAb (ATL-HPA041168) at Atlas Antibodies

Documents & Links for Anti FAAP24 pAb (ATL-HPA041168)
Datasheet Anti FAAP24 pAb (ATL-HPA041168) Datasheet (External Link)
Vendor Page Anti FAAP24 pAb (ATL-HPA041168)