Anti FAAP100 pAb (ATL-HPA023954)

Atlas Antibodies

Catalog No.:
ATL-HPA023954-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia core complex associated protein 100
Gene Name: FAAP100
Alternative Gene Name: C17orf70, FLJ22175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025384: 80%, ENSRNOG00000036699: 81%
Entrez Gene ID: 80233
Uniprot ID: Q0VG06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA
Gene Sequence VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA
Gene ID - Mouse ENSMUSG00000025384
Gene ID - Rat ENSRNOG00000036699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAAP100 pAb (ATL-HPA023954)
Datasheet Anti FAAP100 pAb (ATL-HPA023954) Datasheet (External Link)
Vendor Page Anti FAAP100 pAb (ATL-HPA023954) at Atlas Antibodies

Documents & Links for Anti FAAP100 pAb (ATL-HPA023954)
Datasheet Anti FAAP100 pAb (ATL-HPA023954) Datasheet (External Link)
Vendor Page Anti FAAP100 pAb (ATL-HPA023954)