Anti FAAP100 pAb (ATL-HPA023954)

Atlas Antibodies

SKU: ATL-HPA023954-25

• 
• 

Protein Description: Fanconi anemia core complex associated protein 100
Gene Name: FAAP100
Alternative Gene Name: C17orf70, FLJ22175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025384: 80%, ENSRNOG00000036699: 81%
Entrez Gene ID: 80233
Uniprot ID: Q0VG06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA
• Gene Sequence: VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA
• Gene ID - Mouse: ENSMUSG00000025384
• Gene ID - Rat: ENSRNOG00000036699
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.