Anti FAAH pAb (ATL-HPA007425)

Atlas Antibodies

Catalog No.:
ATL-HPA007425-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fatty acid amide hydrolase
Gene Name: FAAH
Alternative Gene Name: FAAH-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034171: 87%, ENSRNOG00000011019: 84%
Entrez Gene ID: 2166
Uniprot ID: O00519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILK
Gene Sequence YTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILK
Gene ID - Mouse ENSMUSG00000034171
Gene ID - Rat ENSRNOG00000011019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAAH pAb (ATL-HPA007425)
Datasheet Anti FAAH pAb (ATL-HPA007425) Datasheet (External Link)
Vendor Page Anti FAAH pAb (ATL-HPA007425) at Atlas Antibodies

Documents & Links for Anti FAAH pAb (ATL-HPA007425)
Datasheet Anti FAAH pAb (ATL-HPA007425) Datasheet (External Link)
Vendor Page Anti FAAH pAb (ATL-HPA007425)
Citations for Anti FAAH pAb (ATL-HPA007425) – 2 Found
Shubbar, Emman; Helou, Khalil; Kovács, Anikó; Nemes, Szilárd; Hajizadeh, Shahin; Enerbäck, Charlotta; Einbeigi, Zakaria. High levels of γ-glutamyl hydrolase (GGH) are associated with poor prognosis and unfavorable clinical outcomes in invasive breast cancer. Bmc Cancer. 2013;13( 23374458):47.  PubMed
Nielsen, John E; Rolland, Antoine D; Rajpert-De Meyts, Ewa; Janfelt, Christian; Jørgensen, Anne; Winge, Sofia B; Kristensen, David M; Juul, Anders; Chalmel, Frédéric; Jégou, Bernard; Skakkebaek, Niels E. Characterisation and localisation of the endocannabinoid system components in the adult human testis. Scientific Reports. 2019;9(1):12866.  PubMed