Anti F13B pAb (ATL-HPA003827)

Atlas Antibodies

Catalog No.:
ATL-HPA003827-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coagulation factor XIII, B polypeptide
Gene Name: F13B
Alternative Gene Name: FXIIIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026368: 75%, ENSRNOG00000012613: 79%
Entrez Gene ID: 2165
Uniprot ID: P05160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV
Gene Sequence FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV
Gene ID - Mouse ENSMUSG00000026368
Gene ID - Rat ENSRNOG00000012613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti F13B pAb (ATL-HPA003827)
Datasheet Anti F13B pAb (ATL-HPA003827) Datasheet (External Link)
Vendor Page Anti F13B pAb (ATL-HPA003827) at Atlas Antibodies

Documents & Links for Anti F13B pAb (ATL-HPA003827)
Datasheet Anti F13B pAb (ATL-HPA003827) Datasheet (External Link)
Vendor Page Anti F13B pAb (ATL-HPA003827)
Citations for Anti F13B pAb (ATL-HPA003827) – 3 Found
Byrnes, James R; Wilson, Clare; Boutelle, Anthony M; Brandner, Chase B; Flick, Matthew J; Philippou, Helen; Wolberg, Alisa S. The interaction between fibrinogen and zymogen FXIII-A2B2 is mediated by fibrinogen residues γ390-396 and the FXIII-B subunits. Blood. 2016;128(15):1969-1978.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Zhou, Cong; Simpson, Kathryn L; Lancashire, Lee J; Walker, Michael J; Dawson, Martin J; Unwin, Richard D; Rembielak, Agata; Price, Patricia; West, Catharine; Dive, Caroline; Whetton, Anthony D. Statistical considerations of optimal study design for human plasma proteomics and biomarker discovery. Journal Of Proteome Research. 2012;11(4):2103-13.  PubMed