Anti F13B pAb (ATL-HPA003827)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003827-25
![Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/81201/147676/atl-hpa003827_anti-f13b-pab-atl-hpa003827_29300__70017.1681096660.jpg?c=2 "Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: F13B
Alternative Gene Name: FXIIIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026368: 75%, ENSRNOG00000012613: 79%
Entrez Gene ID: 2165
Uniprot ID: P05160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV |
| Gene Sequence | FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV |
| Gene ID - Mouse | ENSMUSG00000026368 |
| Gene ID - Rat | ENSRNOG00000012613 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti F13B pAb (ATL-HPA003827) | |
| Datasheet | Anti F13B pAb (ATL-HPA003827) Datasheet (External Link) |
| Vendor Page | Anti F13B pAb (ATL-HPA003827) at Atlas Antibodies |
| Documents & Links for Anti F13B pAb (ATL-HPA003827) | |
| Datasheet | Anti F13B pAb (ATL-HPA003827) Datasheet (External Link) |
| Vendor Page | Anti F13B pAb (ATL-HPA003827) |
| Citations for Anti F13B pAb (ATL-HPA003827) – 3 Found |
| Byrnes, James R; Wilson, Clare; Boutelle, Anthony M; Brandner, Chase B; Flick, Matthew J; Philippou, Helen; Wolberg, Alisa S. The interaction between fibrinogen and zymogen FXIII-A2B2 is mediated by fibrinogen residues γ390-396 and the FXIII-B subunits. Blood. 2016;128(15):1969-1978. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Zhou, Cong; Simpson, Kathryn L; Lancashire, Lee J; Walker, Michael J; Dawson, Martin J; Unwin, Richard D; Rembielak, Agata; Price, Patricia; West, Catharine; Dive, Caroline; Whetton, Anthony D. Statistical considerations of optimal study design for human plasma proteomics and biomarker discovery. Journal Of Proteome Research. 2012;11(4):2103-13. PubMed |