Anti F12 pAb (ATL-HPA003825)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003825-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: F12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021492: 77%, ENSRNOG00000015139: 81%
Entrez Gene ID: 2161
Uniprot ID: P00748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA |
| Gene Sequence | YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA |
| Gene ID - Mouse | ENSMUSG00000021492 |
| Gene ID - Rat | ENSRNOG00000015139 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti F12 pAb (ATL-HPA003825) | |
| Datasheet | Anti F12 pAb (ATL-HPA003825) Datasheet (External Link) |
| Vendor Page | Anti F12 pAb (ATL-HPA003825) at Atlas Antibodies |
| Documents & Links for Anti F12 pAb (ATL-HPA003825) | |
| Datasheet | Anti F12 pAb (ATL-HPA003825) Datasheet (External Link) |
| Vendor Page | Anti F12 pAb (ATL-HPA003825) |
| Citations for Anti F12 pAb (ATL-HPA003825) – 1 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |