Anti F12 pAb (ATL-HPA003825)

Atlas Antibodies

Catalog No.: ATL-HPA003825-100

Protein Description: coagulation factor XII (Hageman factor)
Gene Name: F12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021492: 77%, ENSRNOG00000015139: 81%
Entrez Gene ID: 2161
Uniprot ID: P00748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA
• Gene Sequence: YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA
• Gene ID - Mouse: ENSMUSG00000021492
• Gene ID - Rat: ENSRNOG00000015139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti F12 pAb (ATL-HPA003825) – 1 Found

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.