Anti EYS pAb (ATL-HPA027103)

Atlas Antibodies

SKU: ATL-HPA027103-25

• 

Protein Description: eyes shut homolog (Drosophila)
Gene Name: EYS
Alternative Gene Name: bA166P24.2, bA307F22.3, bA74E24.1, C6orf178, C6orf179, C6orf180, dJ1018A4.2, dJ303F19.1, EGFL10, EGFL11, RP25, SPAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027878: 45%, ENSRNOG00000019322: 46%
Entrez Gene ID: 346007
Uniprot ID: Q5T1H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
• Gene Sequence: CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
• Gene ID - Mouse: ENSMUSG00000027878
• Gene ID - Rat: ENSRNOG00000019322
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.