Anti EYA4 pAb (ATL-HPA038772)

Atlas Antibodies

Catalog No.:
ATL-HPA038772-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EYA transcriptional coactivator and phosphatase 4
Gene Name: EYA4
Alternative Gene Name: CMD1J, DFNA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010461: 93%, ENSRNOG00000016627: 93%
Entrez Gene ID: 2070
Uniprot ID: O95677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS
Gene Sequence QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS
Gene ID - Mouse ENSMUSG00000010461
Gene ID - Rat ENSRNOG00000016627
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EYA4 pAb (ATL-HPA038772)
Datasheet Anti EYA4 pAb (ATL-HPA038772) Datasheet (External Link)
Vendor Page Anti EYA4 pAb (ATL-HPA038772) at Atlas Antibodies

Documents & Links for Anti EYA4 pAb (ATL-HPA038772)
Datasheet Anti EYA4 pAb (ATL-HPA038772) Datasheet (External Link)
Vendor Page Anti EYA4 pAb (ATL-HPA038772)