Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038771-25

• 
• 

Protein Description: EYA transcriptional coactivator and phosphatase 4
Gene Name: EYA4
Alternative Gene Name: CMD1J, DFNA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010461: 94%, ENSRNOG00000016627: 60%
Entrez Gene ID: 2070
Uniprot ID: O95677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGGENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTFTGSVITSSGYSPRSA
• Gene Sequence: TGGENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTFTGSVITSSGYSPRSA
• Gene ID - Mouse: ENSMUSG00000010461
• Gene ID - Rat: ENSRNOG00000016627
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.