Anti EXTL1 pAb (ATL-HPA037749)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037749-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EXTL1
Alternative Gene Name: EXTL, MGC70794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028838: 60%, ENSRNOG00000016776: 61%
Entrez Gene ID: 2134
Uniprot ID: Q92935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS |
| Gene Sequence | ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS |
| Gene ID - Mouse | ENSMUSG00000028838 |
| Gene ID - Rat | ENSRNOG00000016776 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EXTL1 pAb (ATL-HPA037749) | |
| Datasheet | Anti EXTL1 pAb (ATL-HPA037749) Datasheet (External Link) |
| Vendor Page | Anti EXTL1 pAb (ATL-HPA037749) at Atlas Antibodies |
| Documents & Links for Anti EXTL1 pAb (ATL-HPA037749) | |
| Datasheet | Anti EXTL1 pAb (ATL-HPA037749) Datasheet (External Link) |
| Vendor Page | Anti EXTL1 pAb (ATL-HPA037749) |