Anti EXTL1 pAb (ATL-HPA037749)

Atlas Antibodies

Catalog No.:
ATL-HPA037749-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exostosin-like glycosyltransferase 1
Gene Name: EXTL1
Alternative Gene Name: EXTL, MGC70794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028838: 60%, ENSRNOG00000016776: 61%
Entrez Gene ID: 2134
Uniprot ID: Q92935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS
Gene Sequence ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS
Gene ID - Mouse ENSMUSG00000028838
Gene ID - Rat ENSRNOG00000016776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXTL1 pAb (ATL-HPA037749)
Datasheet Anti EXTL1 pAb (ATL-HPA037749) Datasheet (External Link)
Vendor Page Anti EXTL1 pAb (ATL-HPA037749) at Atlas Antibodies

Documents & Links for Anti EXTL1 pAb (ATL-HPA037749)
Datasheet Anti EXTL1 pAb (ATL-HPA037749) Datasheet (External Link)
Vendor Page Anti EXTL1 pAb (ATL-HPA037749)