Anti EXT1 pAb (ATL-HPA044394)

Atlas Antibodies

SKU: ATL-HPA044394-25

• 

Protein Description: exostosin glycosyltransferase 1
Gene Name: EXT1
Alternative Gene Name: LGCR, LGS, ttv
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061731: 99%, ENSRNOG00000024886: 99%
Entrez Gene ID: 2131
Uniprot ID: Q16394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCL
• Gene Sequence: EDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCL
• Gene ID - Mouse: ENSMUSG00000061731
• Gene ID - Rat: ENSRNOG00000024886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EXT1 pAb (ATL-HPA044394) – 2 Found

Coulson-Thomas, Vivien Jane; Gesteira, Tarsis Ferreira; Esko, Jeffrey; Kao, Winston. Heparan sulfate regulates hair follicle and sebaceous gland morphogenesis and homeostasis. The Journal Of Biological Chemistry. 2014;289(36):25211-26. 

Mohaidat, Ziyad; Bodoor, Khaldon; Almomani, Rowida; Alorjani, Mohammed; Awwad, Mohammad-Akram; Bany-Khalaf, Audai; Al-Batayneh, Khalid. Hereditary multiple osteochondromas in Jordanian patients: Mutational and immunohistochemical analysis of EXT1 and EXT2 genes. Oncology Letters. 2021;21(2):151.