Anti EXT1 pAb (ATL-HPA044394)

Atlas Antibodies

Catalog No.:
ATL-HPA044394-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: exostosin glycosyltransferase 1
Gene Name: EXT1
Alternative Gene Name: LGCR, LGS, ttv
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061731: 99%, ENSRNOG00000024886: 99%
Entrez Gene ID: 2131
Uniprot ID: Q16394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCL
Gene Sequence EDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCL
Gene ID - Mouse ENSMUSG00000061731
Gene ID - Rat ENSRNOG00000024886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXT1 pAb (ATL-HPA044394)
Datasheet Anti EXT1 pAb (ATL-HPA044394) Datasheet (External Link)
Vendor Page Anti EXT1 pAb (ATL-HPA044394) at Atlas Antibodies

Documents & Links for Anti EXT1 pAb (ATL-HPA044394)
Datasheet Anti EXT1 pAb (ATL-HPA044394) Datasheet (External Link)
Vendor Page Anti EXT1 pAb (ATL-HPA044394)
Citations for Anti EXT1 pAb (ATL-HPA044394) – 2 Found
Coulson-Thomas, Vivien Jane; Gesteira, Tarsis Ferreira; Esko, Jeffrey; Kao, Winston. Heparan sulfate regulates hair follicle and sebaceous gland morphogenesis and homeostasis. The Journal Of Biological Chemistry. 2014;289(36):25211-26.  PubMed
Mohaidat, Ziyad; Bodoor, Khaldon; Almomani, Rowida; Alorjani, Mohammed; Awwad, Mohammad-Akram; Bany-Khalaf, Audai; Al-Batayneh, Khalid. Hereditary multiple osteochondromas in Jordanian patients: Mutational and immunohistochemical analysis of EXT1 and EXT2 genes. Oncology Letters. 2021;21(2):151.  PubMed