Anti EXOSC8 pAb (ATL-HPA039702 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039702-100

• 
• 
• 

Protein Description: exosome component 8
Gene Name: EXOSC8
Alternative Gene Name: bA421P11.3, CIP3, EAP2, OIP2, p9, RRP43, Rrp43p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027752: 95%, ENSRNOG00000051623: 60%
Entrez Gene ID: 11340
Uniprot ID: Q96B26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFR
• Gene Sequence: VEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFR
• Gene ID - Mouse: ENSMUSG00000027752
• Gene ID - Rat: ENSRNOG00000051623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.