Anti EXOSC2 pAb (ATL-HPA021790)

Atlas Antibodies

SKU:
ATL-HPA021790-25
  • Immunohistochemical staining of human kidney shows strong positivity in tubules.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exosome component 2
Gene Name: EXOSC2
Alternative Gene Name: hRrp4p, p7, RRP4, Rrp4p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039356: 87%, ENSRNOG00000009245: 91%
Entrez Gene ID: 23404
Uniprot ID: Q13868
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETR
Gene Sequence SVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETR
Gene ID - Mouse ENSMUSG00000039356
Gene ID - Rat ENSRNOG00000009245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOSC2 pAb (ATL-HPA021790)
Datasheet Anti EXOSC2 pAb (ATL-HPA021790) Datasheet (External Link)
Vendor Page Anti EXOSC2 pAb (ATL-HPA021790) at Atlas Antibodies

Documents & Links for Anti EXOSC2 pAb (ATL-HPA021790)
Datasheet Anti EXOSC2 pAb (ATL-HPA021790) Datasheet (External Link)
Vendor Page Anti EXOSC2 pAb (ATL-HPA021790)