Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036285-25

• 
• 

Protein Description: exocyst complex component 6
Gene Name: EXOC6
Alternative Gene Name: DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053799: 63%, ENSRNOG00000036601: 56%
Entrez Gene ID: 54536
Uniprot ID: Q8TAG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
• Gene Sequence: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
• Gene ID - Mouse: ENSMUSG00000053799
• Gene ID - Rat: ENSRNOG00000036601
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation) – 1 Found

Bjørnestad, Synne Arstad; Guadagno, Noemi Antonella; Kjos, Ingrid; Progida, Cinzia. Rab33b-exocyst interaction mediates localized secretion for focal adhesion turnover and cell migration. Iscience. 2022;25(5):104250.