Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036285-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 6
Gene Name: EXOC6
Alternative Gene Name: DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053799: 63%, ENSRNOG00000036601: 56%
Entrez Gene ID: 54536
Uniprot ID: Q8TAG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Gene Sequence TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Gene ID - Mouse ENSMUSG00000053799
Gene ID - Rat ENSRNOG00000036601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation)
Datasheet Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation)
Datasheet Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation)
Citations for Anti EXOC6 pAb (ATL-HPA036285 w/enhanced validation) – 1 Found
Bjørnestad, Synne Arstad; Guadagno, Noemi Antonella; Kjos, Ingrid; Progida, Cinzia. Rab33b-exocyst interaction mediates localized secretion for focal adhesion turnover and cell migration. Iscience. 2022;25(5):104250.  PubMed