Anti EXOC3L4 pAb (ATL-HPA043661)

Atlas Antibodies

SKU:
ATL-HPA043661-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 3-like 4
Gene Name: EXOC3L4
Alternative Gene Name: C14orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021280: 66%, ENSRNOG00000010111: 67%
Entrez Gene ID: 91828
Uniprot ID: Q17RC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQALNDGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQLLRLETLLVAEKASRTFEQDPTAFARRAMDVCLLYDGLA
Gene Sequence RQALNDGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQLLRLETLLVAEKASRTFEQDPTAFARRAMDVCLLYDGLA
Gene ID - Mouse ENSMUSG00000021280
Gene ID - Rat ENSRNOG00000010111
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOC3L4 pAb (ATL-HPA043661)
Datasheet Anti EXOC3L4 pAb (ATL-HPA043661) Datasheet (External Link)
Vendor Page Anti EXOC3L4 pAb (ATL-HPA043661) at Atlas Antibodies

Documents & Links for Anti EXOC3L4 pAb (ATL-HPA043661)
Datasheet Anti EXOC3L4 pAb (ATL-HPA043661) Datasheet (External Link)
Vendor Page Anti EXOC3L4 pAb (ATL-HPA043661)