Anti EXOC1 pAb (ATL-HPA044873)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044873-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EXOC1
Alternative Gene Name: BM-102, FLJ10893, SEC3, SEC3L1, Sec3p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036435: 99%, ENSRNOG00000002144: 98%
Entrez Gene ID: 55763
Uniprot ID: Q9NV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH |
Gene Sequence | CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH |
Gene ID - Mouse | ENSMUSG00000036435 |
Gene ID - Rat | ENSRNOG00000002144 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EXOC1 pAb (ATL-HPA044873) | |
Datasheet | Anti EXOC1 pAb (ATL-HPA044873) Datasheet (External Link) |
Vendor Page | Anti EXOC1 pAb (ATL-HPA044873) at Atlas Antibodies |
Documents & Links for Anti EXOC1 pAb (ATL-HPA044873) | |
Datasheet | Anti EXOC1 pAb (ATL-HPA044873) Datasheet (External Link) |
Vendor Page | Anti EXOC1 pAb (ATL-HPA044873) |