Anti EXOC1 pAb (ATL-HPA044873)

Atlas Antibodies

SKU: ATL-HPA044873-25

• 

Protein Description: exocyst complex component 1
Gene Name: EXOC1
Alternative Gene Name: BM-102, FLJ10893, SEC3, SEC3L1, Sec3p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036435: 99%, ENSRNOG00000002144: 98%
Entrez Gene ID: 55763
Uniprot ID: Q9NV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH
• Gene Sequence: CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH
• Gene ID - Mouse: ENSMUSG00000036435
• Gene ID - Rat: ENSRNOG00000002144
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.