Anti EXOC1 pAb (ATL-HPA037706)

Atlas Antibodies

Catalog No.:
ATL-HPA037706-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: exocyst complex component 1
Gene Name: EXOC1
Alternative Gene Name: BM-102, FLJ10893, SEC3, SEC3L1, Sec3p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036435: 87%, ENSRNOG00000002144: 85%
Entrez Gene ID: 55763
Uniprot ID: Q9NV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA
Gene Sequence FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA
Gene ID - Mouse ENSMUSG00000036435
Gene ID - Rat ENSRNOG00000002144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EXOC1 pAb (ATL-HPA037706)
Datasheet Anti EXOC1 pAb (ATL-HPA037706) Datasheet (External Link)
Vendor Page Anti EXOC1 pAb (ATL-HPA037706) at Atlas Antibodies

Documents & Links for Anti EXOC1 pAb (ATL-HPA037706)
Datasheet Anti EXOC1 pAb (ATL-HPA037706) Datasheet (External Link)
Vendor Page Anti EXOC1 pAb (ATL-HPA037706)
Citations for Anti EXOC1 pAb (ATL-HPA037706) – 2 Found
Bhalla, Manmeet; Van Ngo, Hoan; Gyanwali, Gaurav Chandra; Ireton, Keith. The Host Scaffolding Protein Filamin A and the Exocyst Complex Control Exocytosis during InlB-Mediated Entry of Listeria monocytogenes. Infection And Immunity. 2019;87(1)  PubMed
Osawa, Yuki; Murata, Kazuya; Usui, Miho; Kuba, Yumeno; Le, Hoai Thu; Mikami, Natsuki; Nakagawa, Toshinori; Daitoku, Yoko; Kato, Kanako; Shawki, Hossam Hassan; Ikeda, Yoshihisa; Kuno, Akihiro; Morimoto, Kento; Tanimoto, Yoko; Dinh, Tra Thi Huong; Yagami, Ken-Ichi; Ema, Masatsugu; Yoshida, Shosei; Takahashi, Satoru; Mizuno, Seiya; Sugiyama, Fumihiro. EXOC1 plays an integral role in spermatogonia pseudopod elongation and spermatocyte stable syncytium formation in mice. Elife. 2021;10( 33973520)  PubMed