Anti EXOC1 pAb (ATL-HPA037706)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037706-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: EXOC1
Alternative Gene Name: BM-102, FLJ10893, SEC3, SEC3L1, Sec3p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036435: 87%, ENSRNOG00000002144: 85%
Entrez Gene ID: 55763
Uniprot ID: Q9NV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA |
| Gene Sequence | FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA |
| Gene ID - Mouse | ENSMUSG00000036435 |
| Gene ID - Rat | ENSRNOG00000002144 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EXOC1 pAb (ATL-HPA037706) | |
| Datasheet | Anti EXOC1 pAb (ATL-HPA037706) Datasheet (External Link) |
| Vendor Page | Anti EXOC1 pAb (ATL-HPA037706) at Atlas Antibodies |
| Documents & Links for Anti EXOC1 pAb (ATL-HPA037706) | |
| Datasheet | Anti EXOC1 pAb (ATL-HPA037706) Datasheet (External Link) |
| Vendor Page | Anti EXOC1 pAb (ATL-HPA037706) |
| Citations for Anti EXOC1 pAb (ATL-HPA037706) – 2 Found |
| Bhalla, Manmeet; Van Ngo, Hoan; Gyanwali, Gaurav Chandra; Ireton, Keith. The Host Scaffolding Protein Filamin A and the Exocyst Complex Control Exocytosis during InlB-Mediated Entry of Listeria monocytogenes. Infection And Immunity. 2019;87(1) PubMed |
| Osawa, Yuki; Murata, Kazuya; Usui, Miho; Kuba, Yumeno; Le, Hoai Thu; Mikami, Natsuki; Nakagawa, Toshinori; Daitoku, Yoko; Kato, Kanako; Shawki, Hossam Hassan; Ikeda, Yoshihisa; Kuno, Akihiro; Morimoto, Kento; Tanimoto, Yoko; Dinh, Tra Thi Huong; Yagami, Ken-Ichi; Ema, Masatsugu; Yoshida, Shosei; Takahashi, Satoru; Mizuno, Seiya; Sugiyama, Fumihiro. EXOC1 plays an integral role in spermatogonia pseudopod elongation and spermatocyte stable syncytium formation in mice. Elife. 2021;10( 33973520) PubMed |