Anti EVI5L pAb (ATL-HPA043563)

Atlas Antibodies

Catalog No.:
ATL-HPA043563-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ecotropic viral integration site 5-like
Gene Name: EVI5L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011832: 91%, ENSRNOG00000001034: 89%
Entrez Gene ID: 115704
Uniprot ID: Q96CN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Gene Sequence PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Gene ID - Mouse ENSMUSG00000011832
Gene ID - Rat ENSRNOG00000001034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EVI5L pAb (ATL-HPA043563)
Datasheet Anti EVI5L pAb (ATL-HPA043563) Datasheet (External Link)
Vendor Page Anti EVI5L pAb (ATL-HPA043563) at Atlas Antibodies

Documents & Links for Anti EVI5L pAb (ATL-HPA043563)
Datasheet Anti EVI5L pAb (ATL-HPA043563) Datasheet (External Link)
Vendor Page Anti EVI5L pAb (ATL-HPA043563)