Anti EVI5L pAb (ATL-HPA043563)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043563-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EVI5L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011832: 91%, ENSRNOG00000001034: 89%
Entrez Gene ID: 115704
Uniprot ID: Q96CN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA |
Gene Sequence | PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA |
Gene ID - Mouse | ENSMUSG00000011832 |
Gene ID - Rat | ENSRNOG00000001034 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EVI5L pAb (ATL-HPA043563) | |
Datasheet | Anti EVI5L pAb (ATL-HPA043563) Datasheet (External Link) |
Vendor Page | Anti EVI5L pAb (ATL-HPA043563) at Atlas Antibodies |
Documents & Links for Anti EVI5L pAb (ATL-HPA043563) | |
Datasheet | Anti EVI5L pAb (ATL-HPA043563) Datasheet (External Link) |
Vendor Page | Anti EVI5L pAb (ATL-HPA043563) |