Anti EVI5L pAb (ATL-HPA043563)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043563-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EVI5L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011832: 91%, ENSRNOG00000001034: 89%
Entrez Gene ID: 115704
Uniprot ID: Q96CN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA |
| Gene Sequence | PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA |
| Gene ID - Mouse | ENSMUSG00000011832 |
| Gene ID - Rat | ENSRNOG00000001034 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EVI5L pAb (ATL-HPA043563) | |
| Datasheet | Anti EVI5L pAb (ATL-HPA043563) Datasheet (External Link) |
| Vendor Page | Anti EVI5L pAb (ATL-HPA043563) at Atlas Antibodies |
| Documents & Links for Anti EVI5L pAb (ATL-HPA043563) | |
| Datasheet | Anti EVI5L pAb (ATL-HPA043563) Datasheet (External Link) |
| Vendor Page | Anti EVI5L pAb (ATL-HPA043563) |