Anti EVI5L pAb (ATL-HPA043099 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043099-25

• 
• 

Protein Description: ecotropic viral integration site 5-like
Gene Name: EVI5L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011832: 96%, ENSRNOG00000001034: 51%
Entrez Gene ID: 115704
Uniprot ID: Q96CN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVRQQCSSAAEDLQKAQSTIRQLQEQQENPRLTEDFVSHLETELEQSRLRETETL
• Gene Sequence: VVRQQCSSAAEDLQKAQSTIRQLQEQQENPRLTEDFVSHLETELEQSRLRETETL
• Gene ID - Mouse: ENSMUSG00000011832
• Gene ID - Rat: ENSRNOG00000001034
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.