Anti EVI5 pAb (ATL-HPA027339)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027339-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EVI5
Alternative Gene Name: NB4S
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011831: 90%, ENSRNOG00000002039: 89%
Entrez Gene ID: 7813
Uniprot ID: O60447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSPD |
Gene Sequence | MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSPD |
Gene ID - Mouse | ENSMUSG00000011831 |
Gene ID - Rat | ENSRNOG00000002039 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EVI5 pAb (ATL-HPA027339) | |
Datasheet | Anti EVI5 pAb (ATL-HPA027339) Datasheet (External Link) |
Vendor Page | Anti EVI5 pAb (ATL-HPA027339) at Atlas Antibodies |
Documents & Links for Anti EVI5 pAb (ATL-HPA027339) | |
Datasheet | Anti EVI5 pAb (ATL-HPA027339) Datasheet (External Link) |
Vendor Page | Anti EVI5 pAb (ATL-HPA027339) |
Citations for Anti EVI5 pAb (ATL-HPA027339) – 1 Found |
Baron, Beverly W; Anastasi, John; Bies, Juraj; Reddy, Poluru L; Joseph, Loren; Thirman, Michael J; Wroblewski, Kristen; Wolff, Linda; Baron, Joseph M. GFI1B, EVI5, MYB--additional genes that cooperate with the human BCL6 gene to promote the development of lymphomas. Blood Cells, Molecules & Diseases. 2014;52(1):68-75. PubMed |