Anti EVC2 pAb (ATL-HPA048122)

Atlas Antibodies

Catalog No.: ATL-HPA048122-25

Protein Description: Ellis van Creveld syndrome 2
Gene Name: EVC2
Alternative Gene Name: LBN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050248: 79%, ENSRNOG00000007025: 78%
Entrez Gene ID: 132884
Uniprot ID: Q86UK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYESKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHLSPQV
• Gene Sequence: QYESKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHLSPQV
• Gene ID - Mouse: ENSMUSG00000050248
• Gene ID - Rat: ENSRNOG00000007025
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.