Anti EVC2 pAb (ATL-HPA048122)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048122-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EVC2
Alternative Gene Name: LBN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050248: 79%, ENSRNOG00000007025: 78%
Entrez Gene ID: 132884
Uniprot ID: Q86UK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QYESKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHLSPQV |
| Gene Sequence | QYESKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHLSPQV |
| Gene ID - Mouse | ENSMUSG00000050248 |
| Gene ID - Rat | ENSRNOG00000007025 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EVC2 pAb (ATL-HPA048122) | |
| Datasheet | Anti EVC2 pAb (ATL-HPA048122) Datasheet (External Link) |
| Vendor Page | Anti EVC2 pAb (ATL-HPA048122) at Atlas Antibodies |
| Documents & Links for Anti EVC2 pAb (ATL-HPA048122) | |
| Datasheet | Anti EVC2 pAb (ATL-HPA048122) Datasheet (External Link) |
| Vendor Page | Anti EVC2 pAb (ATL-HPA048122) |