Anti EVC2 pAb (ATL-HPA048122)

Atlas Antibodies

Catalog No.:
ATL-HPA048122-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ellis van Creveld syndrome 2
Gene Name: EVC2
Alternative Gene Name: LBN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050248: 79%, ENSRNOG00000007025: 78%
Entrez Gene ID: 132884
Uniprot ID: Q86UK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYESKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHLSPQV
Gene Sequence QYESKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHLSPQV
Gene ID - Mouse ENSMUSG00000050248
Gene ID - Rat ENSRNOG00000007025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EVC2 pAb (ATL-HPA048122)
Datasheet Anti EVC2 pAb (ATL-HPA048122) Datasheet (External Link)
Vendor Page Anti EVC2 pAb (ATL-HPA048122) at Atlas Antibodies

Documents & Links for Anti EVC2 pAb (ATL-HPA048122)
Datasheet Anti EVC2 pAb (ATL-HPA048122) Datasheet (External Link)
Vendor Page Anti EVC2 pAb (ATL-HPA048122)