Anti ETV7 pAb (ATL-HPA049689)

Atlas Antibodies

Catalog No.:
ATL-HPA049689-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ETS variant 7
Gene Name: ETV7
Alternative Gene Name: TEL-2, TEL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030199: 38%, ENSRNOG00000005984: 38%
Entrez Gene ID: 51513
Uniprot ID: Q9Y603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC
Gene Sequence EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC
Gene ID - Mouse ENSMUSG00000030199
Gene ID - Rat ENSRNOG00000005984
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETV7 pAb (ATL-HPA049689)
Datasheet Anti ETV7 pAb (ATL-HPA049689) Datasheet (External Link)
Vendor Page Anti ETV7 pAb (ATL-HPA049689) at Atlas Antibodies

Documents & Links for Anti ETV7 pAb (ATL-HPA049689)
Datasheet Anti ETV7 pAb (ATL-HPA049689) Datasheet (External Link)
Vendor Page Anti ETV7 pAb (ATL-HPA049689)