Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA029033-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ETV7
Alternative Gene Name: TEL-2, TEL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030199: 33%, ENSRNOG00000005984: 33%
Entrez Gene ID: 51513
Uniprot ID: Q9Y603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK |
Gene Sequence | LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK |
Gene ID - Mouse | ENSMUSG00000030199 |
Gene ID - Rat | ENSRNOG00000005984 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) | |
Datasheet | Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) | |
Datasheet | Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) |
Citations for Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) – 3 Found |
Sang, Yi; Cheng, Chun; Zeng, Yi-Xin; Kang, Tiebang. Snail promotes metastasis of nasopharyngeal carcinoma partly by down-regulating TEL2. Cancer Communications (London, England). 2018;38(1):58. PubMed |
Froggatt, Heather M; Harding, Alfred T; Chaparian, Ryan R; Heaton, Nicholas S. ETV7 limits antiviral gene expression and control of influenza viruses. Science Signaling. 2021;14(691) PubMed |
Sang, Yi; Chen, Ming-Yuan; Luo, Donghua; Zhang, Ru-Hua; Wang, Li; Li, Mei; Luo, Rongzhen; Qian, Chao-Nan; Shao, Jian-Yong; Zeng, Yi-Xin; Kang, Tiebang. TEL2 suppresses metastasis by down-regulating SERPINE1 in nasopharyngeal carcinoma. Oncotarget. 2015;6(30):29240-53. PubMed |