Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029033-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line HDLM-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ets variant 7
Gene Name: ETV7
Alternative Gene Name: TEL-2, TEL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030199: 33%, ENSRNOG00000005984: 33%
Entrez Gene ID: 51513
Uniprot ID: Q9Y603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK
Gene Sequence LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK
Gene ID - Mouse ENSMUSG00000030199
Gene ID - Rat ENSRNOG00000005984
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation)
Datasheet Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation)
Datasheet Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation)



Citations for Anti ETV7 pAb (ATL-HPA029033 w/enhanced validation) – 3 Found
Sang, Yi; Cheng, Chun; Zeng, Yi-Xin; Kang, Tiebang. Snail promotes metastasis of nasopharyngeal carcinoma partly by down-regulating TEL2. Cancer Communications (London, England). 2018;38(1):58.  PubMed
Froggatt, Heather M; Harding, Alfred T; Chaparian, Ryan R; Heaton, Nicholas S. ETV7 limits antiviral gene expression and control of influenza viruses. Science Signaling. 2021;14(691)  PubMed
Sang, Yi; Chen, Ming-Yuan; Luo, Donghua; Zhang, Ru-Hua; Wang, Li; Li, Mei; Luo, Rongzhen; Qian, Chao-Nan; Shao, Jian-Yong; Zeng, Yi-Xin; Kang, Tiebang. TEL2 suppresses metastasis by down-regulating SERPINE1 in nasopharyngeal carcinoma. Oncotarget. 2015;6(30):29240-53.  PubMed