Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000264-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ETV6
Alternative Gene Name: TEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030199: 87%, ENSRNOG00000005984: 92%
Entrez Gene ID: 2120
Uniprot ID: P41212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR |
| Gene Sequence | NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR |
| Gene ID - Mouse | ENSMUSG00000030199 |
| Gene ID - Rat | ENSRNOG00000005984 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) | |
| Datasheet | Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) | |
| Datasheet | Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) |
| Citations for Anti ETV6 pAb (ATL-HPA000264 w/enhanced validation) – 5 Found |
| Teppo, Susanna; Laukkanen, Saara; Liuksiala, Thomas; Nordlund, Jessica; Oittinen, Mikko; Teittinen, Kaisa; Grönroos, Toni; St-Onge, Pascal; Sinnett, Daniel; Syvänen, Ann-Christine; Nykter, Matti; Viiri, Keijo; Heinäniemi, Merja; Lohi, Olli. Genome-wide repression of eRNA and target gene loci by the ETV6-RUNX1 fusion in acute leukemia. Genome Research. 2016;26(11):1468-1477. PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Osmanbeyoglu, Hatice U; Shimizu, Fumiko; Rynne-Vidal, Angela; Alonso-Curbelo, Direna; Chen, Hsuan-An; Wen, Hannah Y; Yeung, Tsz-Lun; Jelinic, Petar; Razavi, Pedram; Lowe, Scott W; Mok, Samuel C; Chiosis, Gabriela; Levine, Douglas A; Leslie, Christina S. Chromatin-informed inference of transcriptional programs in gynecologic and basal breast cancers. Nature Communications. 2019;10(1):4369. PubMed |
| Marino, Dario; Pizzi, Marco; Kotova, Iuliia; Schmidt, Ronny; Schröder, Christoph; Guzzardo, Vincenza; Talli, Ilaria; Peroni, Edoardo; Finotto, Silvia; Scapinello, Greta; Dei Tos, Angelo Paolo; Piazza, Francesco; Trentin, Livio; Zagonel, Vittorina; Piovan, Erich. High ETV6 Levels Support Aggressive B Lymphoma Cell Survival and Predict Poor Outcome in Diffuse Large B-Cell Lymphoma Patients. Cancers. 2022;14(2) PubMed |
| Wray, Jason P; Deltcheva, Elitza M; Boiers, Charlotta; Richardson, Simon Е; Chhetri, Jyoti Bikram; Brown, John; Gagrica, Sladjana; Guo, Yanping; Illendula, Anuradha; Martens, Joost H A; Stunnenberg, Hendrik G; Bushweller, John H; Nimmo, Rachael; Enver, Tariq. Regulome analysis in B-acute lymphoblastic leukemia exposes Core Binding Factor addiction as a therapeutic vulnerability. Nature Communications. 2022;13(1):7124. PubMed |