Anti ETS2 pAb (ATL-HPA003176)

Atlas Antibodies

SKU:
ATL-HPA003176-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: v-ets avian erythroblastosis virus E26 oncogene homolog 2
Gene Name: ETS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022895: 94%, ENSRNOG00000001647: 94%
Entrez Gene ID: 2114
Uniprot ID: P15036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLE
Gene Sequence IKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLE
Gene ID - Mouse ENSMUSG00000022895
Gene ID - Rat ENSRNOG00000001647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETS2 pAb (ATL-HPA003176)
Datasheet Anti ETS2 pAb (ATL-HPA003176) Datasheet (External Link)
Vendor Page Anti ETS2 pAb (ATL-HPA003176) at Atlas Antibodies

Documents & Links for Anti ETS2 pAb (ATL-HPA003176)
Datasheet Anti ETS2 pAb (ATL-HPA003176) Datasheet (External Link)
Vendor Page Anti ETS2 pAb (ATL-HPA003176)