Anti ETNK1 pAb (ATL-HPA010712)

Atlas Antibodies

Catalog No.:
ATL-HPA010712-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ethanolamine kinase 1
Gene Name: ETNK1
Alternative Gene Name: EKI, EKI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030275: 91%, ENSRNOG00000014856: 91%
Entrez Gene ID: 55500
Uniprot ID: Q9HBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR
Gene Sequence ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR
Gene ID - Mouse ENSMUSG00000030275
Gene ID - Rat ENSRNOG00000014856
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETNK1 pAb (ATL-HPA010712)
Datasheet Anti ETNK1 pAb (ATL-HPA010712) Datasheet (External Link)
Vendor Page Anti ETNK1 pAb (ATL-HPA010712) at Atlas Antibodies

Documents & Links for Anti ETNK1 pAb (ATL-HPA010712)
Datasheet Anti ETNK1 pAb (ATL-HPA010712) Datasheet (External Link)
Vendor Page Anti ETNK1 pAb (ATL-HPA010712)