Anti ETNK1 pAb (ATL-HPA010712)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010712-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ETNK1
Alternative Gene Name: EKI, EKI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030275: 91%, ENSRNOG00000014856: 91%
Entrez Gene ID: 55500
Uniprot ID: Q9HBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR |
Gene Sequence | ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR |
Gene ID - Mouse | ENSMUSG00000030275 |
Gene ID - Rat | ENSRNOG00000014856 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ETNK1 pAb (ATL-HPA010712) | |
Datasheet | Anti ETNK1 pAb (ATL-HPA010712) Datasheet (External Link) |
Vendor Page | Anti ETNK1 pAb (ATL-HPA010712) at Atlas Antibodies |
Documents & Links for Anti ETNK1 pAb (ATL-HPA010712) | |
Datasheet | Anti ETNK1 pAb (ATL-HPA010712) Datasheet (External Link) |
Vendor Page | Anti ETNK1 pAb (ATL-HPA010712) |