Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA029029-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/86971/158632/atl-hpa029029_anti-ethe1-pab-atl-hpa029029-wenhanced-validation_40266__95990.1681109792.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ETHE1
Alternative Gene Name: HSCO, YF13H12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064254: 93%, ENSRNOG00000019982: 92%
Entrez Gene ID: 23474
Uniprot ID: O95571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCG |
| Gene Sequence | RTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCG |
| Gene ID - Mouse | ENSMUSG00000064254 |
| Gene ID - Rat | ENSRNOG00000019982 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) | |
| Datasheet | Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) | |
| Datasheet | Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) |
| Citations for Anti ETHE1 pAb (ATL-HPA029029 w/enhanced validation) – 2 Found |
| Luna-Sánchez, Marta; Hidalgo-Gutiérrez, Agustín; Hildebrandt, Tatjana M; Chaves-Serrano, Julio; Barriocanal-Casado, Eliana; Santos-Fandila, Ángela; Romero, Miguel; Sayed, Ramy Ka; Duarte, Juan; Prokisch, Holger; Schuelke, Markus; Distelmaier, Felix; Escames, Germaine; Acuña-Castroviejo, Darío; López, Luis C. CoQ deficiency causes disruption of mitochondrial sulfide oxidation, a new pathomechanism associated with this syndrome. Embo Molecular Medicine. 2017;9(1):78-95. PubMed |
| González-García, Pilar; Hidalgo-Gutiérrez, Agustín; Mascaraque, Cristina; Barriocanal-Casado, Eliana; Bakkali, Mohammed; Ziosi, Marcello; Abdihankyzy, Ussipbek Botagoz; Sánchez-Hernández, Sabina; Escames, Germaine; Prokisch, Holger; Martín, Francisco; Quinzii, Catarina M; López, Luis C. Coenzyme Q10 modulates sulfide metabolism and links the mitochondrial respiratory chain to pathways associated to one carbon metabolism. Human Molecular Genetics. 2020;29(19):3296-3311. PubMed |