Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028360-100
  • Immunohistochemistry analysis in human colon and testis tissues using Anti-ETHE1 antibody. Corresponding ETHE1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ETHE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402306).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ethylmalonic encephalopathy 1
Gene Name: ETHE1
Alternative Gene Name: HSCO, YF13H12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064254: 94%, ENSRNOG00000019982: 94%
Entrez Gene ID: 23474
Uniprot ID: O95571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCG
Gene Sequence ADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCG
Gene ID - Mouse ENSMUSG00000064254
Gene ID - Rat ENSRNOG00000019982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation)
Datasheet Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation)
Datasheet Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETHE1 pAb (ATL-HPA028360 w/enhanced validation)