Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044255-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: electron transfer flavoprotein regulatory factor 1
Gene Name: ETFRF1
Alternative Gene Name: LYRM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040370: 91%, ENSRNOG00000015848: 93%
Entrez Gene ID: 144363
Uniprot ID: Q6IPR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN
Gene Sequence LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN
Gene ID - Mouse ENSMUSG00000040370
Gene ID - Rat ENSRNOG00000015848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation)
Datasheet Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation)
Datasheet Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation)