Anti ETFRF1 pAb (ATL-HPA044255 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044255-25

• 
• 
• 

Protein Description: electron transfer flavoprotein regulatory factor 1
Gene Name: ETFRF1
Alternative Gene Name: LYRM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040370: 91%, ENSRNOG00000015848: 93%
Entrez Gene ID: 144363
Uniprot ID: Q6IPR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN
• Gene Sequence: LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN
• Gene ID - Mouse: ENSMUSG00000040370
• Gene ID - Rat: ENSRNOG00000015848
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.