Anti ETFBKMT pAb (ATL-HPA039024)

Atlas Antibodies

SKU:
ATL-HPA039024-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: electron transfer flavoprotein beta subunit lysine methyltransferase
Gene Name: ETFBKMT
Alternative Gene Name: C12orf72, DKFZp451L235, METTL20, MGC50559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039958: 95%, ENSRNOG00000036918: 95%
Entrez Gene ID: 254013
Uniprot ID: Q8IXQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCELNRLNP
Gene Sequence PYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCELNRLNP
Gene ID - Mouse ENSMUSG00000039958
Gene ID - Rat ENSRNOG00000036918
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETFBKMT pAb (ATL-HPA039024)
Datasheet Anti ETFBKMT pAb (ATL-HPA039024) Datasheet (External Link)
Vendor Page Anti ETFBKMT pAb (ATL-HPA039024) at Atlas Antibodies

Documents & Links for Anti ETFBKMT pAb (ATL-HPA039024)
Datasheet Anti ETFBKMT pAb (ATL-HPA039024) Datasheet (External Link)
Vendor Page Anti ETFBKMT pAb (ATL-HPA039024)