Anti ETFB pAb (ATL-HPA018910 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018910-25

• 
• 
• 

Protein Description: electron-transfer-flavoprotein, beta polypeptide
Gene Name: ETFB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004610: 93%, ENSRNOG00000017851: 93%
Entrez Gene ID: 2109
Uniprot ID: P38117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI
• Gene Sequence: GLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI
• Gene ID - Mouse: ENSMUSG00000004610
• Gene ID - Rat: ENSRNOG00000017851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.