Anti ETFA pAb (ATL-HPA018990 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018990-100
  • Immunohistochemical staining of human gastrointestinal, heart muscle, kidney and liver using Anti-ETFA antibody HPA018990 (A) shows similar protein distribution across tissues to independent antibody HPA018996 (B).
  • Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: electron-transfer-flavoprotein, alpha polypeptide
Gene Name: ETFA
Alternative Gene Name: EMA, GA2, MADD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032314: 100%, ENSRNOG00000015233: 100%
Entrez Gene ID: 2108
Uniprot ID: P13804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEILK
Gene Sequence VDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEILK
Gene ID - Mouse ENSMUSG00000032314
Gene ID - Rat ENSRNOG00000015233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETFA pAb (ATL-HPA018990 w/enhanced validation)
Datasheet Anti ETFA pAb (ATL-HPA018990 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETFA pAb (ATL-HPA018990 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ETFA pAb (ATL-HPA018990 w/enhanced validation)
Datasheet Anti ETFA pAb (ATL-HPA018990 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ETFA pAb (ATL-HPA018990 w/enhanced validation)



Citations for Anti ETFA pAb (ATL-HPA018990 w/enhanced validation) – 2 Found
Bugarski, Milica; Martins, Joana Raquel; Haenni, Dominik; Hall, Andrew M. Multiphoton imaging reveals axial differences in metabolic autofluorescence signals along the kidney proximal tubule. American Journal Of Physiology. Renal Physiology. 2018;315(6):F1613-F1625.  PubMed
Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.  PubMed