Anti ETAA1 pAb (ATL-HPA035048)

Atlas Antibodies

SKU:
ATL-HPA035048-25
  • Immunohistochemical staining of human kidney shows distinct nuclear and cytoplasmic positivity in tubular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ETAA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412840).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Ewing tumor-associated antigen 1
Gene Name: ETAA1
Alternative Gene Name: ETAA16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016984: 45%, ENSRNOG00000006185: 50%
Entrez Gene ID: 54465
Uniprot ID: Q9NY74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK
Gene Sequence DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK
Gene ID - Mouse ENSMUSG00000016984
Gene ID - Rat ENSRNOG00000006185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ETAA1 pAb (ATL-HPA035048)
Datasheet Anti ETAA1 pAb (ATL-HPA035048) Datasheet (External Link)
Vendor Page Anti ETAA1 pAb (ATL-HPA035048) at Atlas Antibodies

Documents & Links for Anti ETAA1 pAb (ATL-HPA035048)
Datasheet Anti ETAA1 pAb (ATL-HPA035048) Datasheet (External Link)
Vendor Page Anti ETAA1 pAb (ATL-HPA035048)