Anti ETAA1 pAb (ATL-HPA035048)

Atlas Antibodies

Catalog No.: ATL-HPA035048-25

Protein Description: Ewing tumor-associated antigen 1
Gene Name: ETAA1
Alternative Gene Name: ETAA16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016984: 45%, ENSRNOG00000006185: 50%
Entrez Gene ID: 54465
Uniprot ID: Q9NY74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK
• Gene Sequence: DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK
• Gene ID - Mouse: ENSMUSG00000016984
• Gene ID - Rat: ENSRNOG00000006185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.