Anti ETAA1 pAb (ATL-HPA035048)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035048-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ETAA1
Alternative Gene Name: ETAA16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016984: 45%, ENSRNOG00000006185: 50%
Entrez Gene ID: 54465
Uniprot ID: Q9NY74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK |
Gene Sequence | DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK |
Gene ID - Mouse | ENSMUSG00000016984 |
Gene ID - Rat | ENSRNOG00000006185 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ETAA1 pAb (ATL-HPA035048) | |
Datasheet | Anti ETAA1 pAb (ATL-HPA035048) Datasheet (External Link) |
Vendor Page | Anti ETAA1 pAb (ATL-HPA035048) at Atlas Antibodies |
Documents & Links for Anti ETAA1 pAb (ATL-HPA035048) | |
Datasheet | Anti ETAA1 pAb (ATL-HPA035048) Datasheet (External Link) |
Vendor Page | Anti ETAA1 pAb (ATL-HPA035048) |