Anti ESYT3 pAb (ATL-HPA039200)

Atlas Antibodies

SKU: ATL-HPA039200-25

• 

Protein Description: extended synaptotagmin-like protein 3
Gene Name: ESYT3
Alternative Gene Name: CHR3SYT, FAM62C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037681: 76%, ENSRNOG00000022704: 72%
Entrez Gene ID: 83850
Uniprot ID: A0FGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD
• Gene Sequence: PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD
• Gene ID - Mouse: ENSMUSG00000037681
• Gene ID - Rat: ENSRNOG00000022704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ESYT3 pAb (ATL-HPA039200) – 2 Found

Fernández-Busnadiego, Rubén; Saheki, Yasunori; De Camilli, Pietro. Three-dimensional architecture of extended synaptotagmin-mediated endoplasmic reticulum-plasma membrane contact sites. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(16):E2004-13. 

Jauregui, Estela J; Mitchell, Debra; Garza, Savanna M; Topping, Traci; Hogarth, Cathryn A; Griswold, Michael D. Leydig cell genes change their expression and association with polysomes in a stage-specific manner in the adult mouse testis. Biology Of Reproduction. 2018;98(5):722-738.