Anti ESYT3 pAb (ATL-HPA039200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039200-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ESYT3
Alternative Gene Name: CHR3SYT, FAM62C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037681: 76%, ENSRNOG00000022704: 72%
Entrez Gene ID: 83850
Uniprot ID: A0FGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD |
Gene Sequence | PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD |
Gene ID - Mouse | ENSMUSG00000037681 |
Gene ID - Rat | ENSRNOG00000022704 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ESYT3 pAb (ATL-HPA039200) | |
Datasheet | Anti ESYT3 pAb (ATL-HPA039200) Datasheet (External Link) |
Vendor Page | Anti ESYT3 pAb (ATL-HPA039200) at Atlas Antibodies |
Documents & Links for Anti ESYT3 pAb (ATL-HPA039200) | |
Datasheet | Anti ESYT3 pAb (ATL-HPA039200) Datasheet (External Link) |
Vendor Page | Anti ESYT3 pAb (ATL-HPA039200) |
Citations for Anti ESYT3 pAb (ATL-HPA039200) – 2 Found |
Fernández-Busnadiego, Rubén; Saheki, Yasunori; De Camilli, Pietro. Three-dimensional architecture of extended synaptotagmin-mediated endoplasmic reticulum-plasma membrane contact sites. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(16):E2004-13. PubMed |
Jauregui, Estela J; Mitchell, Debra; Garza, Savanna M; Topping, Traci; Hogarth, Cathryn A; Griswold, Michael D. Leydig cell genes change their expression and association with polysomes in a stage-specific manner in the adult mouse testis. Biology Of Reproduction. 2018;98(5):722-738. PubMed |