Anti ESYT1 pAb (ATL-HPA016858 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA016858-100

Protein Description: extended synaptotagmin-like protein 1
Gene Name: ESYT1
Alternative Gene Name: FAM62A, KIAA0747, MBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025366: 89%, ENSRNOG00000060753: 88%
Entrez Gene ID: 23344
Uniprot ID: Q9BSJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE
• Gene Sequence: LEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTE
• Gene ID - Mouse: ENSMUSG00000025366
• Gene ID - Rat: ENSRNOG00000060753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ESYT1 pAb (ATL-HPA016858 w/enhanced validation) – 6 Found

Fernández-Busnadiego, Rubén; Saheki, Yasunori; De Camilli, Pietro. Three-dimensional architecture of extended synaptotagmin-mediated endoplasmic reticulum-plasma membrane contact sites. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(16):E2004-13. 

Idevall-Hagren, Olof; Lü, Alice; Xie, Beichen; De Camilli, Pietro. Triggered Ca2+ influx is required for extended synaptotagmin 1-induced ER-plasma membrane tethering. The Embo Journal. 2015;34(17):2291-305. 

Kang, Fei; Zhou, Mengxuan; Huang, Xiaoshuai; Fan, Junchao; Wei, Lisi; Boulanger, Jerome; Liu, Zengzhen; Salamero, Jean; Liu, Yanmei; Chen, Liangyi. E-syt1 Re-arranges STIM1 Clusters to Stabilize Ring-shaped ER-PM Contact Sites and Accelerate Ca(2+) Store Replenishment. Scientific Reports. 2019;9(1):3975. 

Yamada, Kohji; Motohashi, Saya; Oikawa, Tsunekazu; Tago, Naoko; Koizumi, Rei; Ono, Masaya; Tachibana, Toshiaki; Yoshida, Ayano; Yoshida, Saishu; Shimoda, Masayuki; Oka, Masahiro; Yoneda, Yoshihiro; Yoshida, Kiyotsugu. Extended-synaptotagmin 1 engages in unconventional protein secretion mediated via SEC22B(+) vesicle pathway in liver cancer. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2022;119(36):e2202730119. 

Sassano, Maria Livia; van Vliet, Alexander R; Vervoort, Ellen; Van Eygen, Sofie; Van den Haute, Chris; Pavie, Benjamin; Roels, Joris; Swinnen, Johannes V; Spinazzi, Marco; Moens, Leen; Casteels, Kristina; Meyts, Isabelle; Pinton, Paolo; Marchi, Saverio; Rochin, Leila; Giordano, Francesca; Felipe-Abrio, Blanca; Agostinis, Patrizia. PERK recruits E-Syt1 at ER-mitochondria contacts for mitochondrial lipid transport and respiration. The Journal Of Cell Biology. 2023;222(3) 

Stephan, Gabriele; Erdjument-Bromage, Hediye; Liu, Wenke; Frenster, Joshua D; Ravn-Boess, Niklas; Bready, Devin; Cai, Julia; Fenyo, David; Neubert, Thomas; Placantonakis, Dimitris G. Modulation of GPR133 (ADGRD1) Signaling by its Intracellular Interaction Partner Extended Synaptotagmin 1 (ESYT1). Biorxiv : The Preprint Server For Biology. 2023; 36798364( 36798364)