Anti ESRRG pAb (ATL-HPA044678)

Atlas Antibodies

Catalog No.:
ATL-HPA044678-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: estrogen-related receptor gamma
Gene Name: ESRRG
Alternative Gene Name: NR3B3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026610: 100%, ENSRNOG00000002593: 100%
Entrez Gene ID: 2104
Uniprot ID: P62508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
Gene Sequence SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
Gene ID - Mouse ENSMUSG00000026610
Gene ID - Rat ENSRNOG00000002593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ESRRG pAb (ATL-HPA044678)
Datasheet Anti ESRRG pAb (ATL-HPA044678) Datasheet (External Link)
Vendor Page Anti ESRRG pAb (ATL-HPA044678) at Atlas Antibodies

Documents & Links for Anti ESRRG pAb (ATL-HPA044678)
Datasheet Anti ESRRG pAb (ATL-HPA044678) Datasheet (External Link)
Vendor Page Anti ESRRG pAb (ATL-HPA044678)