Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067104-25

• 
• 

Protein Description: epithelial splicing regulatory protein 1
Gene Name: ESRP1
Alternative Gene Name: FLJ20171, RBM35A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040728: 95%, ENSRNOG00000008184: 95%
Entrez Gene ID: 54845
Uniprot ID: Q6NXG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT
• Gene Sequence: LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT
• Gene ID - Mouse: ENSMUSG00000040728
• Gene ID - Rat: ENSRNOG00000008184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.