Anti ESPN pAb (ATL-HPA060220)

Atlas Antibodies

Catalog No.:
ATL-HPA060220-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: espin
Gene Name: ESPN
Alternative Gene Name: DFNB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028943: 74%, ENSRNOG00000010270: 74%
Entrez Gene ID: 83715
Uniprot ID: B1AK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGA
Gene Sequence PKVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGA
Gene ID - Mouse ENSMUSG00000028943
Gene ID - Rat ENSRNOG00000010270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ESPN pAb (ATL-HPA060220)
Datasheet Anti ESPN pAb (ATL-HPA060220) Datasheet (External Link)
Vendor Page Anti ESPN pAb (ATL-HPA060220) at Atlas Antibodies

Documents & Links for Anti ESPN pAb (ATL-HPA060220)
Datasheet Anti ESPN pAb (ATL-HPA060220) Datasheet (External Link)
Vendor Page Anti ESPN pAb (ATL-HPA060220)