Anti ESPN pAb (ATL-HPA060220)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060220-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ESPN
Alternative Gene Name: DFNB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028943: 74%, ENSRNOG00000010270: 74%
Entrez Gene ID: 83715
Uniprot ID: B1AK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGA |
| Gene Sequence | PKVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGA |
| Gene ID - Mouse | ENSMUSG00000028943 |
| Gene ID - Rat | ENSRNOG00000010270 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ESPN pAb (ATL-HPA060220) | |
| Datasheet | Anti ESPN pAb (ATL-HPA060220) Datasheet (External Link) |
| Vendor Page | Anti ESPN pAb (ATL-HPA060220) at Atlas Antibodies |
| Documents & Links for Anti ESPN pAb (ATL-HPA060220) | |
| Datasheet | Anti ESPN pAb (ATL-HPA060220) Datasheet (External Link) |
| Vendor Page | Anti ESPN pAb (ATL-HPA060220) |