Anti ESCO1 pAb (ATL-HPA042497)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042497-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ESCO1
Alternative Gene Name: EFO1, ESO1, KIAA1911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024293: 59%, ENSRNOG00000014031: 64%
Entrez Gene ID: 114799
Uniprot ID: Q5FWF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ERAPENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKIDTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEI |
| Gene Sequence | ERAPENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKIDTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEI |
| Gene ID - Mouse | ENSMUSG00000024293 |
| Gene ID - Rat | ENSRNOG00000014031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ESCO1 pAb (ATL-HPA042497) | |
| Datasheet | Anti ESCO1 pAb (ATL-HPA042497) Datasheet (External Link) |
| Vendor Page | Anti ESCO1 pAb (ATL-HPA042497) at Atlas Antibodies |
| Documents & Links for Anti ESCO1 pAb (ATL-HPA042497) | |
| Datasheet | Anti ESCO1 pAb (ATL-HPA042497) Datasheet (External Link) |
| Vendor Page | Anti ESCO1 pAb (ATL-HPA042497) |
| Citations for Anti ESCO1 pAb (ATL-HPA042497) – 1 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |