Anti ESAM pAb (ATL-HPA051043)

Atlas Antibodies

Catalog No.:
ATL-HPA051043-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: endothelial cell adhesion molecule
Gene Name: ESAM
Alternative Gene Name: W117m
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001946: 72%, ENSRNOG00000033217: 72%
Entrez Gene ID: 90952
Uniprot ID: Q96AP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL
Gene Sequence DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL
Gene ID - Mouse ENSMUSG00000001946
Gene ID - Rat ENSRNOG00000033217
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ESAM pAb (ATL-HPA051043)
Datasheet Anti ESAM pAb (ATL-HPA051043) Datasheet (External Link)
Vendor Page Anti ESAM pAb (ATL-HPA051043) at Atlas Antibodies

Documents & Links for Anti ESAM pAb (ATL-HPA051043)
Datasheet Anti ESAM pAb (ATL-HPA051043) Datasheet (External Link)
Vendor Page Anti ESAM pAb (ATL-HPA051043)