Anti ERRFI1 pAb (ATL-HPA027206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027206-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ERRFI1
Alternative Gene Name: GENE-33, MIG-6, RALT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028967: 89%, ENSRNOG00000058186: 88%
Entrez Gene ID: 54206
Uniprot ID: Q9UJM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY |
| Gene Sequence | NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY |
| Gene ID - Mouse | ENSMUSG00000028967 |
| Gene ID - Rat | ENSRNOG00000058186 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ERRFI1 pAb (ATL-HPA027206) | |
| Datasheet | Anti ERRFI1 pAb (ATL-HPA027206) Datasheet (External Link) |
| Vendor Page | Anti ERRFI1 pAb (ATL-HPA027206) at Atlas Antibodies |
| Documents & Links for Anti ERRFI1 pAb (ATL-HPA027206) | |
| Datasheet | Anti ERRFI1 pAb (ATL-HPA027206) Datasheet (External Link) |
| Vendor Page | Anti ERRFI1 pAb (ATL-HPA027206) |
| Citations for Anti ERRFI1 pAb (ATL-HPA027206) – 2 Found |
| Vu, Ha Linh; Rosenbaum, Sheera; Capparelli, Claudia; Purwin, Timothy J; Davies, Michael A; Berger, Adam C; Aplin, Andrew E. MIG6 Is MEK Regulated and Affects EGF-Induced Migration in Mutant NRAS Melanoma. The Journal Of Investigative Dermatology. 2016;136(2):453-463. PubMed |
| Jäger, Katharina; Larribère, Lionel; Wu, Huizi; Weiss, Christel; Gebhardt, Christoffer; Utikal, Jochen. Expression of Neural Crest Markers GLDC and ERRFI1 is Correlated with Melanoma Prognosis. Cancers. 2019;11(1) PubMed |