Anti ERRFI1 pAb (ATL-HPA027206)

Atlas Antibodies

Catalog No.:
ATL-HPA027206-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ERBB receptor feedback inhibitor 1
Gene Name: ERRFI1
Alternative Gene Name: GENE-33, MIG-6, RALT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028967: 89%, ENSRNOG00000058186: 88%
Entrez Gene ID: 54206
Uniprot ID: Q9UJM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY
Gene Sequence NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY
Gene ID - Mouse ENSMUSG00000028967
Gene ID - Rat ENSRNOG00000058186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERRFI1 pAb (ATL-HPA027206)
Datasheet Anti ERRFI1 pAb (ATL-HPA027206) Datasheet (External Link)
Vendor Page Anti ERRFI1 pAb (ATL-HPA027206) at Atlas Antibodies

Documents & Links for Anti ERRFI1 pAb (ATL-HPA027206)
Datasheet Anti ERRFI1 pAb (ATL-HPA027206) Datasheet (External Link)
Vendor Page Anti ERRFI1 pAb (ATL-HPA027206)
Citations for Anti ERRFI1 pAb (ATL-HPA027206) – 2 Found
Vu, Ha Linh; Rosenbaum, Sheera; Capparelli, Claudia; Purwin, Timothy J; Davies, Michael A; Berger, Adam C; Aplin, Andrew E. MIG6 Is MEK Regulated and Affects EGF-Induced Migration in Mutant NRAS Melanoma. The Journal Of Investigative Dermatology. 2016;136(2):453-463.  PubMed
Jäger, Katharina; Larribère, Lionel; Wu, Huizi; Weiss, Christel; Gebhardt, Christoffer; Utikal, Jochen. Expression of Neural Crest Markers GLDC and ERRFI1 is Correlated with Melanoma Prognosis. Cancers. 2019;11(1)  PubMed