Anti ERP44 pAb (ATL-HPA001318)

Atlas Antibodies

Catalog No.:
ATL-HPA001318-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum protein 44
Gene Name: ERP44
Alternative Gene Name: KIAA0573, PDIA10, TXNDC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028343: 90%, ENSRNOG00000005841: 90%
Entrez Gene ID: 23071
Uniprot ID: Q9BS26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Gene Sequence VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Gene ID - Mouse ENSMUSG00000028343
Gene ID - Rat ENSRNOG00000005841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERP44 pAb (ATL-HPA001318)
Datasheet Anti ERP44 pAb (ATL-HPA001318) Datasheet (External Link)
Vendor Page Anti ERP44 pAb (ATL-HPA001318) at Atlas Antibodies

Documents & Links for Anti ERP44 pAb (ATL-HPA001318)
Datasheet Anti ERP44 pAb (ATL-HPA001318) Datasheet (External Link)
Vendor Page Anti ERP44 pAb (ATL-HPA001318)