Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039456-100

Protein Description: endoplasmic reticulum protein 29
Gene Name: ERP29
Alternative Gene Name: C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029616: 97%, ENSRNOG00000001348: 100%
Entrez Gene ID: 10961
Uniprot ID: P30040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
• Gene Sequence: ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
• Gene ID - Mouse: ENSMUSG00000029616
• Gene ID - Rat: ENSRNOG00000001348
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.