Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039456-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum protein 29
Gene Name: ERP29
Alternative Gene Name: C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029616: 97%, ENSRNOG00000001348: 100%
Entrez Gene ID: 10961
Uniprot ID: P30040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
Gene Sequence ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
Gene ID - Mouse ENSMUSG00000029616
Gene ID - Rat ENSRNOG00000001348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation)
Datasheet Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation)
Datasheet Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERP29 pAb (ATL-HPA039456 w/enhanced validation)