Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039636-25
  • Immunohistochemistry analysis in human pancreas and colon tissues using Anti-ERP27 antibody. Corresponding ERP27 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ERP27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407647).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum protein 27
Gene Name: ERP27
Alternative Gene Name: C12orf46, ERp27, FLJ32115, PDIA8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030219: 66%, ENSRNOG00000005787: 57%
Entrez Gene ID: 121506
Uniprot ID: Q96DN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
Gene Sequence ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
Gene ID - Mouse ENSMUSG00000030219
Gene ID - Rat ENSRNOG00000005787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation)
Datasheet Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation)
Datasheet Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERP27 pAb (ATL-HPA039636 w/enhanced validation)