Anti ERO1B pAb (ATL-HPA028085)

Atlas Antibodies

SKU: ATL-HPA028085-25

• 
• 

Protein Description: endoplasmic reticulum oxidoreductase beta
Gene Name: ERO1B
Alternative Gene Name: ERO1-L(beta), Ero1beta, ERO1LB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057069: 92%, ENSRNOG00000002609: 93%
Entrez Gene ID: 56605
Uniprot ID: Q86YB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDE
• Gene Sequence: NLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDE
• Gene ID - Mouse: ENSMUSG00000057069
• Gene ID - Rat: ENSRNOG00000002609
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.