Anti ERLEC1 pAb (ATL-HPA031501 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031501-25
  • Immunohistochemical staining of human cerebral cortex, gastrointestinal, liver and testis using Anti-ERLEC1 antibody HPA031501 (A) shows similar protein distribution across tissues to independent antibody HPA031502 (B).
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum lectin 1
Gene Name: ERLEC1
Alternative Gene Name: C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020311: 94%, ENSRNOG00000007283: 94%
Entrez Gene ID: 27248
Uniprot ID: Q96DZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE
Gene Sequence PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE
Gene ID - Mouse ENSMUSG00000020311
Gene ID - Rat ENSRNOG00000007283
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ERLEC1 pAb (ATL-HPA031501 w/enhanced validation)
Datasheet Anti ERLEC1 pAb (ATL-HPA031501 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERLEC1 pAb (ATL-HPA031501 w/enhanced validation)