Anti ERICH4 pAb (ATL-HPA042632)
Atlas Antibodies
- SKU:
- ATL-HPA042632-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ERICH4
Alternative Gene Name: C19orf69, LOC100170765
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074261: 80%, ENSRNOG00000037798: 86%
Entrez Gene ID: 100170765
Uniprot ID: A6NGS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE |
Gene Sequence | SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE |
Gene ID - Mouse | ENSMUSG00000074261 |
Gene ID - Rat | ENSRNOG00000037798 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERICH4 pAb (ATL-HPA042632) | |
Datasheet | Anti ERICH4 pAb (ATL-HPA042632) Datasheet (External Link) |
Vendor Page | Anti ERICH4 pAb (ATL-HPA042632) at Atlas Antibodies |
Documents & Links for Anti ERICH4 pAb (ATL-HPA042632) | |
Datasheet | Anti ERICH4 pAb (ATL-HPA042632) Datasheet (External Link) |
Vendor Page | Anti ERICH4 pAb (ATL-HPA042632) |