Anti ERICH4 pAb (ATL-HPA042632)

Atlas Antibodies

Catalog No.:
ATL-HPA042632-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glutamate-rich 4
Gene Name: ERICH4
Alternative Gene Name: C19orf69, LOC100170765
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074261: 80%, ENSRNOG00000037798: 86%
Entrez Gene ID: 100170765
Uniprot ID: A6NGS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE
Gene Sequence SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE
Gene ID - Mouse ENSMUSG00000074261
Gene ID - Rat ENSRNOG00000037798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERICH4 pAb (ATL-HPA042632)
Datasheet Anti ERICH4 pAb (ATL-HPA042632) Datasheet (External Link)
Vendor Page Anti ERICH4 pAb (ATL-HPA042632) at Atlas Antibodies

Documents & Links for Anti ERICH4 pAb (ATL-HPA042632)
Datasheet Anti ERICH4 pAb (ATL-HPA042632) Datasheet (External Link)
Vendor Page Anti ERICH4 pAb (ATL-HPA042632)