Anti ERICH4 pAb (ATL-HPA042632)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042632-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ERICH4
Alternative Gene Name: C19orf69, LOC100170765
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074261: 80%, ENSRNOG00000037798: 86%
Entrez Gene ID: 100170765
Uniprot ID: A6NGS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE |
| Gene Sequence | SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE |
| Gene ID - Mouse | ENSMUSG00000074261 |
| Gene ID - Rat | ENSRNOG00000037798 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ERICH4 pAb (ATL-HPA042632) | |
| Datasheet | Anti ERICH4 pAb (ATL-HPA042632) Datasheet (External Link) |
| Vendor Page | Anti ERICH4 pAb (ATL-HPA042632) at Atlas Antibodies |
| Documents & Links for Anti ERICH4 pAb (ATL-HPA042632) | |
| Datasheet | Anti ERICH4 pAb (ATL-HPA042632) Datasheet (External Link) |
| Vendor Page | Anti ERICH4 pAb (ATL-HPA042632) |