Anti ERICH3 pAb (ATL-HPA028655)

Atlas Antibodies

SKU:
ATL-HPA028655-25
  • Immunohistochemical staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamate-rich 3
Gene Name: ERICH3
Alternative Gene Name: C1orf173, DKFZp547I048, RP11-653A5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078161: 39%, ENSRNOG00000050178: 28%
Entrez Gene ID: 127254
Uniprot ID: Q5RHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTGPMEDTASKREDGSEEAILGGEEPAKERKEVMRTETRLSPFTGEAEASRMQVSEGSPEEGSLAKEAFLCKEDVEGEEMVTEAEANREDDRKEILPKE
Gene Sequence DTGPMEDTASKREDGSEEAILGGEEPAKERKEVMRTETRLSPFTGEAEASRMQVSEGSPEEGSLAKEAFLCKEDVEGEEMVTEAEANREDDRKEILPKE
Gene ID - Mouse ENSMUSG00000078161
Gene ID - Rat ENSRNOG00000050178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERICH3 pAb (ATL-HPA028655)
Datasheet Anti ERICH3 pAb (ATL-HPA028655) Datasheet (External Link)
Vendor Page Anti ERICH3 pAb (ATL-HPA028655) at Atlas Antibodies

Documents & Links for Anti ERICH3 pAb (ATL-HPA028655)
Datasheet Anti ERICH3 pAb (ATL-HPA028655) Datasheet (External Link)
Vendor Page Anti ERICH3 pAb (ATL-HPA028655)